ATG2A polyclonal antibody View larger

ATG2A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATG2A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ATG2A polyclonal antibody

Brand: Abnova
Reference: PAB23335
Product name: ATG2A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ATG2A.
Isotype: IgG
Gene id: 23130
Gene name: ATG2A
Gene alias: KIAA0404|MGC117153
Gene description: ATG2 autophagy related 2 homolog A (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human ATG2A.
Immunogen sequence/protein sequence: EDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKM
Protein accession: Q2TAZ0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23335-48-70-1.jpg
Application image note: Immunohistochemical staining of human bone marrow with ATG2A polyclonal antibody (Cat # PAB23335) shows strong cytoplasmic positivity in subsets of bone marrow poietic cells and red blood cells at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ATG2A polyclonal antibody now

Add to cart