ACTR6 polyclonal antibody View larger

ACTR6 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACTR6 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ACTR6 polyclonal antibody

Brand: Abnova
Reference: PAB23310
Product name: ACTR6 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ACTR6.
Isotype: IgG
Gene id: 64431
Gene name: ACTR6
Gene alias: ARP6|CDA12|FLJ13433|HSPC281|MSTP136|hARP6|hARPX
Gene description: ARP6 actin-related protein 6 homolog (yeast)
Immunogen: Recombinant protein corresponding to amino acids of human ACTR6.
Immunogen sequence/protein sequence: NAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLLTNHLKEIISYRQLHVMDETHVINQVKEDVCYV
Protein accession: Q9GZN1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23310-48-71-1.jpg
Application image note: Immunohistochemical staining of human thyroid gland with ACTR6 polyclonal antibody (Cat # PAB23310) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ACTR6 polyclonal antibody now

Add to cart