BFSP2 polyclonal antibody View larger

BFSP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BFSP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about BFSP2 polyclonal antibody

Brand: Abnova
Reference: PAB23290
Product name: BFSP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant BFSP2.
Isotype: IgG
Gene id: 8419
Gene name: BFSP2
Gene alias: CP47|CP49|LIFL-L|MGC142078|MGC142080|PHAKOSIN
Gene description: beaded filament structural protein 2, phakinin
Immunogen: Recombinant protein corresponding to amino acids of human BFSP2.
Immunogen sequence/protein sequence: LSRNYEEDVKLLHKQLAGCELEQMDAPIGTGLDDILETIRIQWERDVEKNRVEAGALLQAKQQAEVAHMSQTQEEKLAAALRVE
Protein accession: Q13515
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23290-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with BFSP2 polyclonal antibody (Cat # PAB23290) at 1-4 ug/mL dilution shows positivity in plasma membrane and cytoplasm.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy BFSP2 polyclonal antibody now

Add to cart