WDR48 polyclonal antibody View larger

WDR48 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WDR48 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about WDR48 polyclonal antibody

Brand: Abnova
Reference: PAB23285
Product name: WDR48 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant WDR48.
Isotype: IgG
Gene id: 57599
Gene name: WDR48
Gene alias: DKFZp686G1794|KIAA1449|P80
Gene description: WD repeat domain 48
Immunogen: Recombinant protein corresponding to amino acids of human WDR48.
Immunogen sequence/protein sequence: SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
Protein accession: Q8TAF3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: PAB23285-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with WDR48 polyclonal antibody (Cat # PAB23285) at 1-4 ug/mL dilution shows positivity in vesicles.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy WDR48 polyclonal antibody now

Add to cart