View larger

C10orf32 polyclonal antibody

Reference:

Condition: New product

Data sheet of C10orf32 polyclonal antibody

Brand:	Abnova
Reference:	PAB23142
Product name:	C10orf32 polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against recombinant C10orf32.
Isotype:	IgG
Gene id:	119032
Gene name:	C10orf32
Gene alias:	DKFZp686B2219\|FLJ40752\|MGC27171\|RP11-753C18.6
Gene description:	chromosome 10 open reading frame 32
Immunogen:	Recombinant protein corresponding to amino acids of human C10orf32.
Immunogen sequence/protein sequence:	FGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK
Protein accession:	Q96B45
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (1:500-1:1000) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemical staining of human colon with C10orf32 polyclonal antibody (Cat # PAB23142) shows moderate cytoplasmic and nuclear positivity in glandular cells at 1:500-1:1000 dilution.
Applications:	WB,IHC-P
Shipping condition:	Dry Ice