Cart 49 Product Products 18 174,55 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x BAF170...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
18 174,55 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 49 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 18 174,55 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 18 174,55 €
Data sheet of FAM44A polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about FAM44A polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB23099 |
| Product name: | FAM44A polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant FAM44A. |
| Isotype: | IgG |
| Gene id: | 259282 |
| Gene name: | FAM44A |
| Gene alias: | FLJ33215|KIAA1327 |
| Gene description: | family with sequence similarity 44, member A |
| Immunogen: | Recombinant protein corresponding to amino acids of human FAM44A. |
| Immunogen sequence/protein sequence: | PQVEKAVHEFLATLNHKEEGSGNTAPDDEKPDTSLITQGVPTPGPSANVANDAMSILETITSLNQEASAARASTETSNAKTSE |
| Protein accession: | Q8NFC6 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human placenta with FAM44A polyclonal antibody (Cat # PAB23099) shows moderate nuclear positivity in trophoblastic cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |