LRP2BP polyclonal antibody View larger

LRP2BP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRP2BP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about LRP2BP polyclonal antibody

Brand: Abnova
Reference: PAB23046
Product name: LRP2BP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LRP2BP.
Isotype: IgG
Gene id: 55805
Gene name: LRP2BP
Gene alias: DKFZp761O0113|FLJ44965
Gene description: LRP2 binding protein
Immunogen: Recombinant protein corresponding to amino acids of human LRP2BP.
Immunogen sequence/protein sequence: RILKGDTLAYFLRGQLYFEEGWYEEALEQFEEIKEKDHQATYQLGVMYYDGLGTTLDAEKGVDYMKKILDSPCPKARHLKFAAAYNLGRAYYEGKGVKR
Protein accession: Q9P2M1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23046-48-305-1.jpg
Application image note: Immunohistochemical staining of human bronchus with LRP2BP polyclonal antibody (Cat # PAB23046) shows moderate cytoplasmic and membranous positivity in respiratory epithelial cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy LRP2BP polyclonal antibody now

Add to cart