ARSI polyclonal antibody View larger

ARSI polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARSI polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ARSI polyclonal antibody

Brand: Abnova
Reference: PAB23040
Product name: ARSI polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ARSI.
Isotype: IgG
Gene id: 340075
Gene name: ARSI
Gene alias: FLJ16069
Gene description: arylsulfatase family, member I
Immunogen: Recombinant protein corresponding to amino acids of human ARSI.
Immunogen sequence/protein sequence: TYDNCDGPGVCGFDLHEGENVAWGLSGQYSTMLYAQRASHILASHSPQRPLFLYVAFQAVHTPLQSPREYLYRYRTMGNVA
Protein accession: Q5FYB1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23040-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with ARSI polyclonal antibody (Cat # PAB23040) shows moderate cytoplasmic positivity in neuronal cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ARSI polyclonal antibody now

Add to cart