HNRNPA0 polyclonal antibody View larger

HNRNPA0 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HNRNPA0 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about HNRNPA0 polyclonal antibody

Brand: Abnova
Reference: PAB23029
Product name: HNRNPA0 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant HNRNPA0.
Isotype: IgG
Gene id: 10949
Gene name: HNRNPA0
Gene alias: HNRPA0
Gene description: heterogeneous nuclear ribonucleoprotein A0
Immunogen: Recombinant protein corresponding to amino acids of human HNRNPA0.
Immunogen sequence/protein sequence: RGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGG
Protein accession: Q13151
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23029-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with HNRNPA0 polyclonal antibody (Cat # PAB23029) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy HNRNPA0 polyclonal antibody now

Add to cart