DDX46 polyclonal antibody View larger

DDX46 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDX46 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,IHC-P

More info about DDX46 polyclonal antibody

Brand: Abnova
Reference: PAB23023
Product name: DDX46 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DDX46.
Isotype: IgG
Gene id: 9879
Gene name: DDX46
Gene alias: FLJ25329|KIAA0801|MGC9936|PRPF5
Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
Immunogen: Recombinant protein corresponding to amino acids of human DDX46.
Immunogen sequence/protein sequence: KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM
Protein accession: Q7L014
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB23023-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with DDX46 polyclonal antibody (Cat # PAB23023) shows strong nuclear positivity in seminiferous tubules.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy DDX46 polyclonal antibody now

Add to cart