CUEDC2 polyclonal antibody View larger

CUEDC2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CUEDC2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about CUEDC2 polyclonal antibody

Brand: Abnova
Reference: PAB23022
Product name: CUEDC2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CUEDC2.
Isotype: IgG
Gene id: 79004
Gene name: CUEDC2
Gene alias: C10orf66|MGC2491|bA18I14.5
Gene description: CUE domain containing 2
Immunogen: Recombinant protein corresponding to amino acids of human CUEDC2.
Immunogen sequence/protein sequence: DLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPI
Protein accession: Q9H467
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23022-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with CUEDC2 polyclonal antibody (Cat # PAB23022) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and cytoplasm.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CUEDC2 polyclonal antibody now

Add to cart