CCNJ polyclonal antibody View larger

CCNJ polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCNJ polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about CCNJ polyclonal antibody

Brand: Abnova
Reference: PAB23020
Product name: CCNJ polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CCNJ.
Isotype: IgG
Gene id: 54619
Gene name: CCNJ
Gene alias: bA690P14.1
Gene description: cyclin J
Immunogen: Recombinant protein corresponding to amino acids of human CCNJ.
Immunogen sequence/protein sequence: TRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPT
Protein accession: Q5T5M9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23020-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with CCNJ polyclonal antibody (Cat # PAB23020) shows moderate cytoplasmic positivity in neuronal cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CCNJ polyclonal antibody now

Add to cart