KY polyclonal antibody View larger

KY polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KY polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KY polyclonal antibody

Brand: Abnova
Reference: PAB23013
Product name: KY polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KY.
Isotype: IgG
Gene id: 339855
Gene name: KY
Gene alias: FLJ33207
Gene description: kyphoscoliosis peptidase
Immunogen: Recombinant protein corresponding to amino acids of human KY.
Immunogen sequence/protein sequence: AQGTLSDQQANPSSLLQRGGGFQGVGNGVRRWQKLEGNDFHENLVEKQHPQQPQVITSYNSQGTQLTVEVHPRDAMPQ
Protein accession: Q8NBH2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23013-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with KY polyclonal antibody (Cat # PAB23013) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy KY polyclonal antibody now

Add to cart