ARSJ polyclonal antibody View larger

ARSJ polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARSJ polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ARSJ polyclonal antibody

Brand: Abnova
Reference: PAB23010
Product name: ARSJ polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ARSJ.
Isotype: IgG
Gene id: 79642
Gene name: ARSJ
Gene alias: FLJ23548
Gene description: arylsulfatase family, member J
Immunogen: Recombinant protein corresponding to amino acids of human ARSJ.
Immunogen sequence/protein sequence: DSPGMCGYDLYENDNAAWDYDNGIYSTQMYTQRVQQILASHNPTKPIFLYIAYQAVHSPLQAPGRYFEHYRSIININRRRYAAMLSCLDEAINNV
Protein accession: Q5FYB0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23010-48-44-1.jpg
Application image note: Immunohistochemical staining of human smooth muscle with ARSJ polyclonal antibody (Cat # PAB23010) shows strong cytoplasmic positivity in smooth muscle cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ARSJ polyclonal antibody now

Add to cart