SH3PXD2B polyclonal antibody View larger

SH3PXD2B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH3PXD2B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about SH3PXD2B polyclonal antibody

Brand: Abnova
Reference: PAB23008
Product name: SH3PXD2B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SH3PXD2B.
Isotype: IgG
Gene id: 285590
Gene name: SH3PXD2B
Gene alias: FAD49|FLJ20831|HOFI|KIAA1295
Gene description: SH3 and PX domains 2B
Immunogen: Recombinant protein corresponding to amino acids of human SH3PXD2B.
Immunogen sequence/protein sequence: PPGVILPMMPAKHIPPARDSRRPEPKPDKSRLFQLKNDMGLECGHKVLAKEVKKPNLRPISKSKTDLPEEKPDATPQNPFLKSRPQV
Protein accession: A1X283
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23008-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with SH3PXD2B polyclonal antibody (Cat # PAB23008) shows moderate cytoplasmic positivity in exocrine glandular cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SH3PXD2B polyclonal antibody now

Add to cart