ABHD14B polyclonal antibody View larger

ABHD14B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABHD14B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about ABHD14B polyclonal antibody

Brand: Abnova
Reference: PAB23002
Product name: ABHD14B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ABHD14B.
Isotype: IgG
Gene id: 84836
Gene name: ABHD14B
Gene alias: CIB|MGC15429
Gene description: abhydrolase domain containing 14B
Immunogen: Recombinant protein corresponding to amino acids of human ABHD14B.
Immunogen sequence/protein sequence: PICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFL
Protein accession: Q96IU4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB23002-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with ABHD14B polyclonal antibody (Cat # PAB23002) at 1-4 ug/mL dilution shows positivity in nucleus, nucleoli and cytoplasm.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ABHD14B polyclonal antibody now

Add to cart