UBXN4 polyclonal antibody View larger

UBXN4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBXN4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about UBXN4 polyclonal antibody

Brand: Abnova
Reference: PAB22981
Product name: UBXN4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant UBXN4.
Isotype: IgG
Gene id: 23190
Gene name: UBXN4
Gene alias: FLJ23318|KIAA0242|KIAA2042|UBXD2|UBXDC1|erasin
Gene description: UBX domain protein 4
Immunogen: Recombinant protein corresponding to amino acids of human UBXN4.
Immunogen sequence/protein sequence: ERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIV
Protein accession: Q92575
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22981-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with UBXN4 polyclonal antibody (Cat # PAB22981) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and endoplasmic reticulum.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy UBXN4 polyclonal antibody now

Add to cart