EXOC6 polyclonal antibody View larger

EXOC6 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EXOC6 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about EXOC6 polyclonal antibody

Brand: Abnova
Reference: PAB22976
Product name: EXOC6 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant EXOC6.
Isotype: IgG
Gene id: 54536
Gene name: EXOC6
Gene alias: DKFZp761I2124|EXOC6A|FLJ1125|FLJ11251|MGC33397|SEC15|SEC15L|SEC15L1|SEC15L3|Sec15p
Gene description: exocyst complex component 6
Immunogen: Recombinant protein corresponding to amino acids of human EXOC6.
Immunogen sequence/protein sequence: TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE
Protein accession: Q8TAG9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22976-48-47-1.jpg
Application image note: Immunohistochemical staining of human adrenal gland with EXOC6 polyclonal antibody (Cat # PAB22976) shows strong membranous and cytoplasmic positivity in cortical cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EXOC6 polyclonal antibody now

Add to cart