FAM55C polyclonal antibody View larger

FAM55C polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM55C polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FAM55C polyclonal antibody

Brand: Abnova
Reference: PAB22971
Product name: FAM55C polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FAM55C.
Isotype: IgG
Gene id: 91775
Gene name: FAM55C
Gene alias: FLJ30102|MGC15606|MST115|MSTP115
Gene description: family with sequence similarity 55, member C
Immunogen: Recombinant protein corresponding to amino acids of human FAM55C.
Immunogen sequence/protein sequence: EFNLGSPKNVGPFLAVDQKHNILLKYRCHGPPIRFTTVFSNELHYVANELNGIVGGKNTVVAIAVWSHFSTFPLEVYIRRLRNIRRAVVRLLDRSPKTVVVIRTANAQELGPEVSLFNSDWYNFQLDTILRRMFSGVGVYLVDA
Protein accession: Q969Y0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22971-48-35-1.jpg
Application image note: Immunohistochemical staining of human esophagus with FAM55C polyclonal antibody (Cat # PAB22971) shows strong cytoplasmic positivity in squamous epithelial cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FAM55C polyclonal antibody now

Add to cart