TTLL5 polyclonal antibody View larger

TTLL5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TTLL5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TTLL5 polyclonal antibody

Brand: Abnova
Reference: PAB22614
Product name: TTLL5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TTLL5.
Isotype: IgG
Gene id: 23093
Gene name: TTLL5
Gene alias: KIAA0998|MGC117189|STAMP
Gene description: tubulin tyrosine ligase-like family, member 5
Immunogen: Recombinant protein corresponding to amino acids of human TTLL5.
Immunogen sequence/protein sequence: NKHHSGIAKTQKEGEDASLYSKRYNQSMVTAELQRLAEKQAARQYSPSSHINLLTQQVTNLNLATGIINRSSASAPPTLRPIISPSGP
Protein accession: Q6EMB2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22614-48-3-1.jpg
Application image note: Immunohistochemical staining of human heart muscle with TTLL5 polyclonal antibody (Cat # PAB22614) shows distinct positivity in endothelial cells.
Applications: IHC-P
Shipping condition: Dry Ice
Publications: Biallelic Variants in TTLL5, Encoding a Tubulin Glutamylase, Cause Retinal Dystrophy.Sergouniotis PI, Chakarova C, Murphy C, Becker M, Lenassi E, Arno G, Lek M, MacArthur DG, UCL-Exomes Consortium, Bhattacharya SS, Moore AT, Holder GE, Robson AG, Wolfrum U, Webster AR, Plagnol V.
Am J Hum Genet. 2014 May 1;94(5):760-9.

Reviews

Buy TTLL5 polyclonal antibody now

Add to cart