KLHDC9 polyclonal antibody View larger

KLHDC9 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLHDC9 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KLHDC9 polyclonal antibody

Brand: Abnova
Reference: PAB22607
Product name: KLHDC9 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KLHDC9.
Isotype: IgG
Gene id: 126823
Gene name: KLHDC9
Gene alias: KARCA1|MGC33338|RP11-544M22.9
Gene description: kelch domain containing 9
Immunogen: Recombinant protein corresponding to amino acids of human KLHDC9.
Immunogen sequence/protein sequence: VDGRWLCVVGGWDGSRRLATVTALDTERGVWEAWTGTPGDCPPAGLSSHTCTRISDRELQVAGREGGIHTQRRYGSIYTLRLDPSARTY
Protein accession: Q8NEP7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22607-48-71-1.jpg
Application image note: Immunohistochemical staining of human thyroid gland with KLHDC9 polyclonal antibody (Cat # PAB22607) strong cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy KLHDC9 polyclonal antibody now

Add to cart