ASCC3 polyclonal antibody View larger

ASCC3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ASCC3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ASCC3 polyclonal antibody

Brand: Abnova
Reference: PAB22570
Product name: ASCC3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ASCC3.
Isotype: IgG
Gene id: 10973
Gene name: ASCC3
Gene alias: ASC1p200|DJ467N11.1|HELIC1|MGC26074|RNAH|dJ121G13.4
Gene description: activating signal cointegrator 1 complex subunit 3
Immunogen: Recombinant protein corresponding to amino acids of human ASCC3.
Immunogen sequence/protein sequence: QLNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFSIHHAG
Protein accession: Q8N3C0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22570-48-258-1.jpg
Application image note: Immunohistochemical staining of human rectum with ASCC3 polyclonal antibody (Cat # PAB22570) strong cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ASCC3 polyclonal antibody now

Add to cart