SCUBE2 polyclonal antibody View larger

SCUBE2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCUBE2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SCUBE2 polyclonal antibody

Brand: Abnova
Reference: PAB22360
Product name: SCUBE2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SCUBE2.
Isotype: IgG
Gene id: 57758
Gene name: SCUBE2
Gene alias: CEGP1|Cegb1|Cegf1|FLJ16792|FLJ35234|MGC133057
Gene description: signal peptide, CUB domain, EGF-like 2
Immunogen: Recombinant protein corresponding to amino acids of human SCUBE2.
Immunogen sequence/protein sequence: SGIHLSSDVTTIRTSVTFKLNEGKCSLKNAELFPEGLRPALPEKHSSVKESFRYVNLTCSSGKQVPGAPGRPSTPKEMFITVEFELETNQKEVTASCDLSCIVKRTEKRLRKAIRTLRKAVHREQFHLQLSGMNLDVAK
Protein accession: Q9NQ36
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22360-48-39-1.jpg
Application image note: Immunohistochemical staining of human urinary bladder with SCUBE2 polyclonal antibody (Cat # PAB22360) shows strong cytoplasmic positivity in urothelial cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SCUBE2 polyclonal antibody now

Add to cart