CLDND1 polyclonal antibody View larger

CLDND1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLDND1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about CLDND1 polyclonal antibody

Brand: Abnova
Reference: PAB22357
Product name: CLDND1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CLDND1.
Isotype: IgG
Gene id: 56650
Gene name: CLDND1
Gene alias: C3orf4|GENX-3745|MGC111162|MGC3316|MGC9861
Gene description: claudin domain containing 1
Immunogen: Recombinant protein corresponding to amino acids of human CLDND1.
Immunogen sequence/protein sequence: NMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRC
Protein accession: Q9NY35
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22357-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with CLDND1 polyclonal antibody (Cat # PAB22357) shows strong nucleus and cytoplasmic positivity of cells in seminiferous ducts at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLDND1 polyclonal antibody now

Add to cart