APEH polyclonal antibody View larger

APEH polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APEH polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about APEH polyclonal antibody

Brand: Abnova
Reference: PAB22331
Product name: APEH polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant APEH.
Isotype: IgG
Gene id: 327
Gene name: APEH
Gene alias: ACPH|APH|D3F15S2|D3S48E|DNF15S2|MGC2178|OPH
Gene description: N-acylaminoacyl-peptide hydrolase
Immunogen: Recombinant protein corresponding to amino acids of human APEH.
Immunogen sequence/protein sequence: RQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGTGPGEEKQFLEVWEKNRKLKSFNLSALEKHGPVYEDDCFGC
Protein accession: P13798
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: PAB22331-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with APEH polyclonal antibody (Cat # PAB22331) at 1:250-1:500 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy APEH polyclonal antibody now

Add to cart