ANKRD34A polyclonal antibody View larger

ANKRD34A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANKRD34A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ANKRD34A polyclonal antibody

Brand: Abnova
Reference: PAB22323
Product name: ANKRD34A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ANKRD34A.
Isotype: IgG
Gene id: 284615
Gene name: ANKRD34A
Gene alias: ANKRD34|DKFZp761F202
Gene description: ankyrin repeat domain 34A
Immunogen: Recombinant protein corresponding to amino acids of human ANKRD34A.
Immunogen sequence/protein sequence: SGTKKTRQYLNSPPSPGVEDPAPASPSPGFCTSPSEIQLQTAGGGGRGMLSPRAQEEEEKRDVFEFPLPKPPDDPSPSEPLPKPP
Protein accession: Q69YU3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22323-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with ANKRD34A polyclonal antibody (Cat # PAB22323) at 1-4 ug/mL dilution shows positivity in cytoplasm.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ANKRD34A polyclonal antibody now

Add to cart