| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
| Brand: | Abnova |
| Reference: | PAB22320 |
| Product name: | SLC35B2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant SLC35B2. |
| Isotype: | IgG |
| Gene id: | 347734 |
| Gene name: | SLC35B2 |
| Gene alias: | PAPST1|SLL|UGTrel4 |
| Gene description: | solute carrier family 35, member B2 |
| Immunogen: | Recombinant protein corresponding to amino acids of human SLC35B2. |
| Immunogen sequence/protein sequence: | FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT |
| Protein accession: | Q8TB61 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human gallbladder with SLC35B2 polyclonal antibody (Cat # PAB22320) shows strong membrane positivity in glandular cells at 1:10-1:20 dilution. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |