PHF20 polyclonal antibody View larger

PHF20 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHF20 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about PHF20 polyclonal antibody

Brand: Abnova
Reference: PAB22313
Product name: PHF20 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PHF20.
Isotype: IgG
Gene id: 51230
Gene name: PHF20
Gene alias: C20orf104|FLJ33479|GLEA2|HCA58|NZF|TZP
Gene description: PHD finger protein 20
Immunogen: Recombinant protein corresponding to amino acids of human PHF20.
Immunogen sequence/protein sequence: VRVKPKKKKKKKKKTKPECPCSEEISDTSQEPSPPKAFAVTRCGSSHKPGVHMSPQLHGPESGHHKGKVKALEEDNLSESSSESFLWSDDEYGQDVDVTTNP
Protein accession: Q9BVI0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22313-48-306-1.jpg
Application image note: Immunohistochemical staining of human oral mucosa with PHF20 polyclonal antibody (Cat # PAB22313) shows strong nuclear positivity in squamous epithelial cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy PHF20 polyclonal antibody now

Add to cart