KCND3 polyclonal antibody View larger

KCND3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCND3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KCND3 polyclonal antibody

Brand: Abnova
Reference: PAB22291
Product name: KCND3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KCND3.
Isotype: IgG
Gene id: 3752
Gene name: KCND3
Gene alias: KCND3L|KCND3S|KSHIVB|KV4.3|MGC142035|MGC142037
Gene description: potassium voltage-gated channel, Shal-related subfamily, member 3
Immunogen: Recombinant protein corresponding to amino acids of human KCND3.
Immunogen sequence/protein sequence: NYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVS
Protein accession: Q9UK17
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22291-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with KCND3 polyclonal antibody (Cat # PAB22291) shows moderate positivity in indercalated ducts in exocrine pancreas at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy KCND3 polyclonal antibody now

Add to cart