L1TD1 polyclonal antibody View larger

L1TD1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of L1TD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about L1TD1 polyclonal antibody

Brand: Abnova
Reference: PAB22168
Product name: L1TD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant L1TD1.
Isotype: IgG
Gene id: 54596
Gene name: L1TD1
Gene alias: ECAT11|FLJ10884|MGC133253|RP5-1155K23.3
Gene description: LINE-1 type transposase domain containing 1
Immunogen: Recombinant protein corresponding to amino acids of human L1TD1.
Immunogen sequence/protein sequence: IDSVEDSESEEEEEGKSSETGKVKTTSLTEKKASRRQKEIPFSYLVGDSGKKKLVKHQVVHKTQEEEETAVPTSQGTGTPC
Protein accession: Q5T7N2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22168-48-302-1.jpg
Application image note: Immunohistochemical staining of human nasopharynx with L1TD1 polyclonal antibody (Cat # PAB22168) shows strong cytoplasmic, membranous and nuclear positivity in respiratory epithelial cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy L1TD1 polyclonal antibody now

Add to cart