YOD1 polyclonal antibody View larger

YOD1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YOD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about YOD1 polyclonal antibody

Brand: Abnova
Reference: PAB22141
Product name: YOD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant YOD1.
Isotype: IgG
Gene id: 55432
Gene name: YOD1
Gene alias: DKFZp451J1719|DUBA8|OTUD2|PRO0907
Gene description: YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human YOD1.
Immunogen sequence/protein sequence: DMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVA
Protein accession: Q5VVQ6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22141-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with YOD1 polyclonal antibody (Cat # PAB22141) strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy YOD1 polyclonal antibody now

Add to cart