PARS2 polyclonal antibody View larger

PARS2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PARS2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about PARS2 polyclonal antibody

Brand: Abnova
Reference: PAB22128
Product name: PARS2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PARS2.
Isotype: IgG
Gene id: 25973
Gene name: PARS2
Gene alias: DKFZp727A071|MGC14416|MGC19467|MT-PRORS
Gene description: prolyl-tRNA synthetase 2, mitochondrial (putative)
Immunogen: Recombinant protein corresponding to amino acids of human PARS2.
Immunogen sequence/protein sequence: QLPVDIGEDRLAICPRCSFSANMETLDLSQMNCPACQGPLTKTKGIEVGHTFYLGTKYSSIFNAQFTNVCGKPTLAE
Protein accession: Q7L3T8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22128-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with PARS2 polyclonal antibody (Cat # PAB22128) shows strong cytoplasmic positivity in islet cells and intercalated ducts.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PARS2 polyclonal antibody now

Add to cart