CASZ1 polyclonal antibody View larger

CASZ1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CASZ1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about CASZ1 polyclonal antibody

Brand: Abnova
Reference: PAB22121
Product name: CASZ1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CASZ1.
Isotype: IgG
Gene id: 54897
Gene name: CASZ1
Gene alias: CST|FLJ12223|FLJ20321|SRG|ZNF693|dJ734G22.1
Gene description: castor zinc finger 1
Immunogen: Recombinant protein corresponding to amino acids of human CASZ1.
Immunogen sequence/protein sequence: STMTEFLGMFGYDDQNTRDELARKISFEKLHAGSTPEAATSSMLPTSEDTLSKRARFSKYEEYIRKLKAGEQLSWPAPSTKTEERVGKE
Protein accession: Q86V15
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22121-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with CASZ1 polyclonal antibody (Cat # PAB22121) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and vesicles.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy CASZ1 polyclonal antibody now

Add to cart