RC3H1 polyclonal antibody View larger

RC3H1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RC3H1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about RC3H1 polyclonal antibody

Brand: Abnova
Reference: PAB22050
Product name: RC3H1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RC3H1.
Isotype: IgG
Gene id: 149041
Gene name: RC3H1
Gene alias: KIAA2025|RNF198|ROQUIN
Gene description: ring finger and CCCH-type zinc finger domains 1
Immunogen: Recombinant protein corresponding to amino acids of human RC3H1.
Immunogen sequence/protein sequence: AHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPG
Protein accession: Q5TC82
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22050-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with RC3H1 polyclonal antibody (Cat # PAB22050) shows strong cytoplasmic positivity in renal tubules at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy RC3H1 polyclonal antibody now

Add to cart