| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-P |
| Brand: | Abnova |
| Reference: | PAB22002 |
| Product name: | TTLL4 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant TTLL4. |
| Isotype: | IgG |
| Gene id: | 9654 |
| Gene name: | TTLL4 |
| Gene alias: | KIAA0173 |
| Gene description: | tubulin tyrosine ligase-like family, member 4 |
| Immunogen: | Recombinant protein corresponding to amino acids of human TTLL4. |
| Immunogen sequence/protein sequence: | DGLEDCCSRDENEEEEGDSECSSLSAVSPSESVAMISRSCMEILTKPLSNHEKVVRPALIYSLFPNVPPTIYFGTRDERVEKLPWEQRKLLRWKMSTVTPNIVKQTIGRSHFKISKRNDDWLGCWGHHMKSPSFRSI |
| Protein accession: | Q14679 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with TTLL4 polyclonal antibody (Cat # PAB22002). |
| Applications: | WB,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Klf4 glutamylation is required for cell reprogramming and early embryonic development in mice.Ye B, Liu B, Hao L, Zhu X, Yang L, Wang S, Xia P, Du Y, Meng S, Huang G, Qin X, Wang Y, Yan X, Li C, Hao J, Zhu P, He L, Tian Y, Fan Z. Nat Commun. 2018 Mar 28;9(1):1261. |