SEC11C polyclonal antibody View larger

SEC11C polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEC11C polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about SEC11C polyclonal antibody

Brand: Abnova
Reference: PAB21982
Product name: SEC11C polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SEC11C.
Isotype: IgG
Gene id: 90701
Gene name: SEC11C
Gene alias: SEC11L3|SPC21|SPCS4C
Gene description: SEC11 homolog C (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human SEC11C.
Immunogen sequence/protein sequence: MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV
Protein accession: Q9BY50
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21982-48-10-1.jpg
Application image note: Immunohistochemical staining of human lymph node with SEC11C polyclonal antibody (Cat # PAB21982) shows strong cytoplasmic positivity in subsets of lymphoid cells outside reaction centra at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SEC11C polyclonal antibody now

Add to cart