View larger

FAM135B polyclonal antibody

Reference:

Condition: New product

Data sheet of FAM135B polyclonal antibody

Brand:	Abnova
Reference:	PAB21963
Product name:	FAM135B polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against recombinant FAM135B.
Isotype:	IgG
Gene id:	51059
Gene name:	FAM135B
Gene alias:	C8ORFK32\|MGC126009\|MGC126010\|MGC33221
Gene description:	family with sequence similarity 135, member B
Immunogen:	Recombinant protein corresponding to amino acids of human FAM135B.
Immunogen sequence/protein sequence:	DRTGLSKVVVGGSHQNAISSDKTTLHELSTLGKGIDQEGKMVLLSLKLTPSEPCDPLSSTLREPLDIRSSLKDSHTEEQEELSVLSG
Protein accession:	Q49AJ0
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemical staining of human kidney with FAM135B polyclonal antibody (Cat # PAB21963) shows strong cytoplasmic positivity in tubular cells at 1:50-1:200 dilution.
Applications:	IHC-P
Shipping condition:	Dry Ice