VPS37A polyclonal antibody View larger

VPS37A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VPS37A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about VPS37A polyclonal antibody

Brand: Abnova
Reference: PAB21960
Product name: VPS37A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant VPS37A.
Isotype: IgG
Gene id: 137492
Gene name: VPS37A
Gene alias: FLJ32642|FLJ42616|HCRP1|PQBP2
Gene description: vacuolar protein sorting 37 homolog A (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human VPS37A.
Immunogen sequence/protein sequence: QHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL
Protein accession: Q8NEZ2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21960-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251MG with VPS37A polyclonal antibody (Cat # PAB21960) at 1-4 ug/mL dilution shows positivity in vesicles.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy VPS37A polyclonal antibody now

Add to cart