KLHL38 polyclonal antibody View larger

KLHL38 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLHL38 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KLHL38 polyclonal antibody

Brand: Abnova
Reference: PAB21958
Product name: KLHL38 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KLHL38.
Isotype: IgG
Gene id: 340359
Gene name: KLHL38
Gene alias: C8ORFK36
Gene description: kelch-like 38 (Drosophila)
Immunogen: Recombinant protein corresponding to amino acids of human KLHL38.
Immunogen sequence/protein sequence: VIVGGYTRRILAYDPQSNKFVKCADMKDRRMHHGATVMGNKLYVTGGRRLTTDCNIEDSASFDCYDPETDTWTSQGQLPHKLFDHA
Protein accession: Q2WGJ6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21958-48-6-1.jpg
Application image note: Immunohistochemical staining of human salivary gland with KLHL38 polyclonal antibody (Cat # PAB21958) strong cytoplasmic positivity in glandular cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy KLHL38 polyclonal antibody now

Add to cart