C17orf58 polyclonal antibody View larger

C17orf58 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C17orf58 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about C17orf58 polyclonal antibody

Brand: Abnova
Reference: PAB21942
Product name: C17orf58 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C17orf58.
Isotype: IgG
Gene id: 284018
Gene name: C17orf58
Gene alias: MGC138278
Gene description: chromosome 17 open reading frame 58
Immunogen: Recombinant protein corresponding to amino acids of human C17orf58.
Immunogen sequence/protein sequence: FRVHMLALDSSSCNKPCPEFKPGSRYIVMGHIYHKRRQLPTALLQVLRGRLRPGDGLLRSSSSYVKRFNRKREGQIQGAIH
Protein accession: Q2M2W7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21942-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with C17orf58 polyclonal antibody (Cat # PAB21942) shows strong nuclear positivity in trophoblastic cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy C17orf58 polyclonal antibody now

Add to cart