| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
| Brand: | Abnova |
| Reference: | PAB21918 |
| Product name: | HIVEP3 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant HIVEP3. |
| Isotype: | IgG |
| Gene id: | 59269 |
| Gene name: | HIVEP3 |
| Gene alias: | FLJ16752|KBP-1|KBP1|KIAA1555|KRC|SHN3|Schnurri-3|ZAS3|ZNF40C |
| Gene description: | human immunodeficiency virus type I enhancer binding protein 3 |
| Immunogen: | Recombinant protein corresponding to amino acids of human HIVEP3. |
| Immunogen sequence/protein sequence: | SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTL |
| Protein accession: | Q5T1R4 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human rectum with HIVEP3 polyclonal antibody (Cat # PAB21918) shows strong nuclear and cytoplasmic positivity in glandular cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Combined overexpression of HIVEP3 and SOX9 predicts unfavorable biochemical recurrence-free survival in patients with prostate cancer.Qin GQ, He HC, Han ZD, Liang YX, Yang SB, Huang YQ, Zhou L, Fu H, Li JX, Jiang FN, Zhong WD Onco Targets Ther. 2014 Jan 24;7:137-46. doi: 10.2147/OTT.S55432. eCollection 2014. |