SNRNP40 polyclonal antibody View larger

SNRNP40 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNRNP40 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about SNRNP40 polyclonal antibody

Brand: Abnova
Reference: PAB21895
Product name: SNRNP40 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SNRNP40.
Isotype: IgG
Gene id: 9410
Gene name: SNRNP40
Gene alias: 40K|FLJ41108|HPRP8BP|MGC1910|PRP8BP|PRPF8BP|RP11-490K7.3|SPF38|WDR57
Gene description: small nuclear ribonucleoprotein 40kDa (U5)
Immunogen: Recombinant protein corresponding to amino acids of human SNRNP40.
Immunogen sequence/protein sequence: GDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQ
Protein accession: Q96DI7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21895-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with SNRNP40 polyclonal antibody (Cat # PAB21895) shows strong cytoplasmic and nuclear positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNRNP40 polyclonal antibody now

Add to cart