FLJ35848 polyclonal antibody View larger

FLJ35848 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ35848 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FLJ35848 polyclonal antibody

Brand: Abnova
Reference: PAB21886
Product name: FLJ35848 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FLJ35848.
Isotype: IgG
Gene id: 284071
Gene name: FLJ35848
Gene alias: MGC43301
Gene description: hypothetical protein FLJ35848
Immunogen: Recombinant protein corresponding to amino acids of human FLJ35848.
Immunogen sequence/protein sequence: YCQENPSAFSSFDFSYSGAERIQSVNHIEGLTKPGEENLFKLVTDKKIKQPNGFCDNYSAQKYGIIENVNKHNFQAKPQSGHYDPEEGPKHLDGLSQNTYQDLLESQGHSNSHRTRGGDNSRVNRTQVSCFSNN
Protein accession: A2RUB1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21886-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with FLJ35848 polyclonal antibody (Cat # PAB21886) shows moderate cytoplasmic and membranous positivity in tubular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FLJ35848 polyclonal antibody now

Add to cart