ADPRHL2 polyclonal antibody View larger

ADPRHL2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADPRHL2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about ADPRHL2 polyclonal antibody

Brand: Abnova
Reference: PAB21875
Product name: ADPRHL2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ADPRHL2.
Isotype: IgG
Gene id: 54936
Gene name: ADPRHL2
Gene alias: ARH3|FLJ20446|dJ665N4.2
Gene description: ADP-ribosylhydrolase like 2
Immunogen: Recombinant protein corresponding to amino acids of human ADPRHL2.
Immunogen sequence/protein sequence: VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVV
Protein accession: Q9NX46
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21875-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with ADPRHL2 polyclonal antibody (Cat # PAB21875) at 1-4 ug/mL dilution shows positivity in nuclei but not nucleoli.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ADPRHL2 polyclonal antibody now

Add to cart