UNC50 polyclonal antibody View larger

UNC50 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UNC50 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about UNC50 polyclonal antibody

Brand: Abnova
Reference: PAB21863
Product name: UNC50 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant UNC50.
Isotype: IgG
Gene id: 25972
Gene name: UNC50
Gene alias: DKFZp564G0222|GMH1|HSD23|UNCL|URP
Gene description: unc-50 homolog (C. elegans)
Immunogen: Recombinant protein corresponding to amino acids of human UNC50.
Immunogen sequence/protein sequence: MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRL
Protein accession: Q53HI1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21863-48-36-1.jpg
Application image note: Immunohistochemical staining of human small intestine with UNC50 polyclonal antibody (Cat # PAB21863) shows strong nuclear positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy UNC50 polyclonal antibody now

Add to cart