PRDM10 polyclonal antibody View larger

PRDM10 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRDM10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about PRDM10 polyclonal antibody

Brand: Abnova
Reference: PAB21861
Product name: PRDM10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PRDM10.
Isotype: IgG
Gene id: 56980
Gene name: PRDM10
Gene alias: KIAA1231|MGC131802|PFM7
Gene description: PR domain containing 10
Immunogen: Recombinant protein corresponding to amino acids of human PRDM10.
Immunogen sequence/protein sequence: SPSHIQGSSSTQGQALQQQQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVTTGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSLDPQTNSQQQTTQYIITTTTNGNGS
Protein accession: Q9NQV6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21861-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with PRDM10 polyclonal antibody (Cat # PAB21861) shows strong nuclear positivity in glandular cells while paneth cells displayed additional strong cytoplasmic positivity at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRDM10 polyclonal antibody now

Add to cart