RTP2 polyclonal antibody View larger

RTP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RTP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about RTP2 polyclonal antibody

Brand: Abnova
Reference: PAB21848
Product name: RTP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RTP2.
Isotype: IgG
Gene id: 344892
Gene name: RTP2
Gene alias: MGC78665
Gene description: receptor (chemosensory) transporter protein 2
Immunogen: Recombinant protein corresponding to amino acids of human RTP2.
Immunogen sequence/protein sequence: YRIHVASRPDSGPHRAEFCEACQEGIVHWKPSEKLLEEEVTTYTSEASKPRAQAGSGYNF
Protein accession: Q5QGT7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21848-48-47-1.jpg
Application image note: Immunohistochemical staining of human adrenal gland with RTP2 polyclonal antibody (Cat # PAB21848) shows distinct cytoplasmic and nuclear positivity in cortical cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy RTP2 polyclonal antibody now

Add to cart