PHF13 polyclonal antibody View larger

PHF13 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHF13 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about PHF13 polyclonal antibody

Brand: Abnova
Reference: PAB21841
Product name: PHF13 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PHF13.
Isotype: IgG
Gene id: 148479
Gene name: PHF13
Gene alias: MGC43399|PHF5|SPOC1
Gene description: PHD finger protein 13
Immunogen: Recombinant protein corresponding to amino acids of human PHF13.
Immunogen sequence/protein sequence: GKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHT
Protein accession: Q86YI8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21841-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with PHF13 polyclonal antibody (Cat # PAB21841) shows strong membranous positivity in tubular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PHF13 polyclonal antibody now

Add to cart