IQCK polyclonal antibody View larger

IQCK polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IQCK polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about IQCK polyclonal antibody

Brand: Abnova
Reference: PAB21838
Product name: IQCK polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant IQCK.
Isotype: IgG
Gene id: 124152
Gene name: IQCK
Gene alias: FLJ20115|FLJ36575|MGC35048
Gene description: IQ motif containing K
Immunogen: Recombinant protein corresponding to amino acids of human IQCK.
Immunogen sequence/protein sequence: ERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQ
Protein accession: Q8N0W5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21838-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with IQCK polyclonal antibody (Cat # PAB21838) shows strong granular cytoplasmic positivity in glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IQCK polyclonal antibody now

Add to cart