No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
| Brand: | Abnova |
| Reference: | PAB21625 |
| Product name: | ARHGAP27 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant ARHGAP27. |
| Isotype: | IgG |
| Gene id: | 201176 |
| Gene name: | ARHGAP27 |
| Gene alias: | CAMGAP1|FLJ43547|MGC120624 |
| Gene description: | Rho GTPase activating protein 27 |
| Immunogen: | Recombinant protein corresponding to amino acids of human ARHGAP27. |
| Immunogen sequence/protein sequence: | WTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQE |
| Protein accession: | Q6ZUM4 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining of human bone marrow with ARHGAP27 polyclonal antibody (Cat # PAB21625) shows strong cytoplasmic positivity in a subset of bone marrow poietic cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |